<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4398 CA20526 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDC 25
2 3TC+D4T+IDV 72
3 3TC+D4T+RTV+SQV 76
4 APV+D4T+DDI+NVP+RTV 38
5 ABC+D4T+IDV+RTV 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, R41RK, K43KR, I62V, L63P, H69Y, A71T, I72E, V77I, I93L  
>CA20526| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWRPKMIGGIGGFIKVRQYD
QVPIEICGYKTEGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W   K103N, Y181YC   S68G, K122E, I135IT, S162A, I178M, Q207E, R211K, T215X, E233ED, A272P V10S
>CA20137| codons 1-274
PISPIETVPSKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDMVI
CQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFXTPDKKHQKEPPFLWMGYDLHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005