<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4375 CA20523 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 AZT+3TC 21
3 D4T+3TC+IDV 56
4 3TC+AZT+DDI+IDV+NVP 12
5 D4T+DLV+NFV+SQV 107
6 3TC+ABC+D4T+DDI 81

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, I84IV, L90M K43T L10I, E35D, M36I, R41RK, I62V, L63Q, I64V, A71AV, I93IL, C95CS F53SY, G68GA
>CA20523| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGKWTPKIIGGIGGSVKVRQYD
QVQVEICAHKVIGTVLVGPTPFNVIGRNLMTQLGSTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y K219R Y188L A98G K20R, T39TA, E44D, V60VI, V118I, K122E, I142V, Q197E, T200A, I202V, E203K, H208Y, K223Q, V245E  
>CA20127| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLLVGSDLEIGEHRAKVKELRQYLWRWGFYTPDRKHQQEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009