<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8015 CA20517 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+NFV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90LM N88D I13LV, L24X, E35D, M36I, K45KQ, L63P, I64V, A71AV P9PL
>CA20517| codons 1-99
PQITLWQRLLVTLKIGGQLKEALXDTGADNTVLEDINLPGRWKPQMIGGIGGFIKVRQYD
QIPVEICGHKVIGTVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, M184V       T69N, K122E, I135T, E169D, R211K, A272P I274IM, A299AG
>CA20128| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGMKVKQLCKLLRGTKALTEVIPLTEEGE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005