<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4514 CA20511 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 23
2 3TC+AZT+IDV 33
3 D4T+DDI+RTV 90
4 D4T+DDI+NFV 45
5 3TC+ABC+AZT+RTV 65

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82C, L90M N88D L10I, E34Q, R41K, Q61N, L63P, V77I, I93L  
>CA20511| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMNLPGKWKPKMIGGIGGFVKVRQYD
NIPIEICGHKAIGTVLIGPTPCNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, K122E, D123S, I135IR, D177E, I178M, G196E, F214L, D237E, V245M, D250E, A272P, K277R, I293V H198HQ, A299AG
>CA20122| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIEQQRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPEKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEGE
LEL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009