<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8009 CA20508 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 196
2 AZT+DDC 140
3 3TC+DDI+IDV 180

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, L76LV, V82A L24I, Q58QE L10I, I15IV, K20KR, E35ED, M36I, N37D, R41RK, K45KN, I62V, L63P, I64V, A71AV, I72V, I93L  
>CA20508| codons 1-99
PQITLWQRPIVTIKVGGQLREALIDTGADDTVLEDIDLPGKWKPNIIGGIGGFVKVREYD
QVPVEICGHKVVGTVVVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, M184V, L210W T215D     E6EK, K20R, V60I, V118I, K122E, I135V, E169K, K173E, Q174QR, D177E, T200A, Q207E, R211K, A272P, K275R, T286A A299AG
>CA20119| codons 1-303
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILKPFRERNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGAKALTEVIPLTEEGE
LEL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005