<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4812 CA20497 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 110
2 AZT+DDI 40
3 3TC+AZT 94
4 DLV+NFV+SQV 116
5 APV+D4T+DDI 17
6 D4T+DDI 14
7 3TC+DDI+IDV+NFV+RTV 9
8 3TC+APV+DDI+NFV+RTV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M Q58E L10V, I13V, F53Y, L63P  
>CA20497| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGYIKVREYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       E6D, K11KQ, V35LM, T39A, E40X, K43E, D123E, I142V, D177E, I178LM, Q207QH, H208HY, R211RK, L228LH, A272P, K277R, T286A, I293V, G335D, P345Q, M357T, A360V, A371AV, I375V, T386I, K390R, A400T, V435VIM, D460N, V467I, H483HY, K527KQ, K558KR Q269QE, K275KN, L283FV
>CA20104| codons 1-560
PISPIDTVPVQLKPGMDGPKVKQWPLTEEKIKALLEICAXLEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRHYLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASEIYPGINVRQLCKLFRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEQFKNLKTGKYARTRGV
HTNDVKQLTEVVQKVATESIVIWGKIPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIMGAETFYVDGAANRETKLGKAGYVTNRGRQKVISLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIQKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRRVL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005