<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8012 CA20491 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 69
2 AZT+ 3TC+ NFV 113
3 D4T+ DDI+ RTV+ SQV 13
4 D4T+ DDI+ APV 59

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54L, L90M L33F, N88D L10I, K14R, N37D, K55KR, L63P, A71T, I72T, I93L  
>CA20491| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADNTVFEEMDLPGRWKPKMIGGIGGFLRVRQYD
QIPIEICGHKTTGTVLVGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     V35I, R83K, V118I, K122E, I135V, T139K, V179VI, T200A, Q207E, R211K, F214L, I244V, V245I, A272P, K277R, L283I, T286P  
>CA20123| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPVILPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGPKALTEVIPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009