<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7989 CA20489 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 57
2 AZT+DDC 39
3 3TC+AZT 61
4 3TC+AZT+NFV 172

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, A22V, L63P, A71V, I72V, V77I, L89LIM, I93L  
>CA20489| codons 1-99
PQITLWQRPIVTIKIGGQLKEVLLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVVGTVLIGPTPVNIIGRDMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     K101KQ, K122E, D123S, E169ED, R211Q, F214L, A272P, K277R, T286A, A288AT  
>CA20079| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLQWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKTLTEVIPLTEEAE
LEL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005