<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1556 CA20481 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDC 14
3 DDI 27
4 D4T 21
5 3TC+AZT 58
6 3TC+AZT+IDV 48
7 D4T+NFV 25
8 DDC+NFV+RTV+SQV 16
9 3TC+RTV+SQV 5
10 ABC+EFV+RTV+SQV 44
11 ABC+APV+D4T+RTV 37
12 3TC+EFV+NVP 15
13 3TC+EFV+LPV+NVP 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54V, I84V, L90M L33F, G73S, L89V I15V, L19P, K20T, E35G, M36I, K43KQ, I62V, L63P, A71I, P79A  
>CA20481| codons 14-99
KVGGQPTEALLDTGADDTIFEGINLPGRWQPKMIGGIGGFVKVRQYDQVPIEICGHKIIS
TVLVGATPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_SG, L74V, M184V, L210W A62V, D67E, T215C L100I, K103N   K43E, K64R, V111I, K122E, I135T, S162Y, R211RK, H221HY, L228H, V245E, A272P  
>CA20092| codons 1-272
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FVIRKKESAKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDIGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFCTPDKKYQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005