<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7991 CA20463 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 None 109
3 3TC+AZT 56
4 D4T+DDI+DLV 9
5 D4T+DDI+NFV 168

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46MI N88D N37NH, R41K, L63P, V77I  
>CA20463| codons 14-99
KIGGQLKEALLDTGADNTVLEEMHLPGKWKPKIIGGIGGFIKVRQYDQIPIEICGHKAIG
TVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y D67G, K219N K103KN   K11KR, K43KE, E44D, S68G, V118I, K122E, D123E, I135T, S162C, I178L, V179I, I202V, V245T, A272P Q242QE
>CA20081| codons 1-274
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEEDGKISKIGPENPYNTPV
FAIKKKGGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLII
YQYMDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VEPITLPEKDSWTVNDIQKLVGKLNWASQIYPGI

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009