<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1503 CA20459 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDC 104
3 NRTI 173
4 D4T 30
5 D4T+ DDI 26
6 SQV+ DDI+ D4T 26
7 IDV+ D4T+ 3TC 17
8 NVP+ D4T+ 3TC 4
9 NFV+ AZT+ 3TC 53
10 NFV+ D4T+ 3TC 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13IV, E35ED, M36MI, N37NS, L63X, I64IV, A71V, V77I, I93IL  
>CA20459| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDISLPGRWKPKMIGGIGGFIKVRQYD
QIXVEICGHKVIGTVLIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005