Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA1503 | CA20459 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 104 |
| 2 | DDC | 104 |
| 3 | NRTI | 173 |
| 4 | D4T | 30 |
| 5 | D4T+ DDI | 26 |
| 6 | SQV+ DDI+ D4T | 26 |
| 7 | IDV+ D4T+ 3TC | 17 |
| 8 | NVP+ D4T+ 3TC | 4 |
| 9 | NFV+ AZT+ 3TC | 53 |
| 10 | NFV+ D4T+ 3TC | 11 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| D30N | N88D | I13IV, E35ED, M36MI, N37NS, L63X, I64IV, A71V, V77I, I93IL |
| >CA20459| codons 1-99 PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDISLPGRWKPKMIGGIGGFIKVRQYD QIXVEICGHKVIGTVLIGPTPVNIIGRDLLTQLGCTLNF |
References
| Author | Title | Citation |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |