<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1543 CA20456 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 208
2 AZT+ DDC+ DDI+ NFV+ SQV NA
3 D4T+ 3TC+ IDV+ NVP 76
4 D4T+ RTV+ SQV+ DDI+ ADV 15
5 D4T+ RTV+ SQV+ DDI+ ADV+ NFV 3
6 D4T+ SQV+ DDI+ ADV+ NFV 13
7 None 3
8 D4T+ SQV+ DDI+ NFV 15
9 None 8
10 D4T+3TC+IDV+RTV+EFV 12
11 D4T+3TC+IDV+RTV 19
12 3TC+APV+D4T+LPV+NVP 1
13 3TC+D4T+IDV+LPV+NVP 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L10F, G73AT L63P, I64V, I66IV, V77I, I85V, I93L  
>CA20456| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPVEVCGHKAIATVLIGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219R K103N   K43E, E44A, A98S, V118I, I135T, H208Y, R211E, L228H, Q242H, V245L, K259E, L260V R143RT, V261RS
>CA20057| codons 1-263
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGITYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWEWGFYTPDRKHQKEPPFHWMGYELHPDKWT
VHPILLPEKDSWTVNDIQEVRGK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005