<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1869 CA20427 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 72
2 D4T+DLV+RTV+SQV 9
3 3TC+AZT+IDV 56
4 D4T+EFV+NFV 37
5 ABC+APV+D4T 18
6 None 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82VA L24I L10I, I15V, R41K, L63P, T74TS  
>CA20427| codons 1-99
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPIEICGHKAIGSVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML       S3SC, E44ED, K49R, R83K, K166R, I167V, V245E, E248D, D250E, A272P, K277R, T290Q K281K*
>CA20033| codons 1-291
PICPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRVLEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLC*LLRGTKALQE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005