<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3910 CA20414 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 72
2 AZT+ D4T 29
3 3TC+ SQV+ AZT 67
4 D4T+ 3TC+ NFV 32
5 RTV+ SQV+ NVP 70
6 EFV+ DDI 30
7 RTV+ SQV+ ABC 50

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M L23I L10I, P39A, D60DE, I62IV, L63P, A71V, V77I  
>CA20414| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVLEEMNLAGRWKPKLIGGIGGFVKVRQYE
QVPIEICGHKVIGTVLIGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   Y181C, G190A   E6EK, K20R, V35T, T39A, K43Q, E44D, K101T, K102Q, K122E, S163SR, T200TI, Q207E, H208Y, R211K L168LV
>CA20021| codons 1-285
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLTQKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSRMTKIVEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRIKIEELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRG

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005