<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5970 CA20411 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+AZT+IDV NA
3 3TC+AZT+NFV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IL, L90M   I3IV, L10I, E35D, M36I, N37S, I62V, L63P, A71V, T74S, V77I, I93L  
>CA20411| codons 1-99
PQVTLWQRPIVTIKIGGQLKEALLDTGADDTVLEDISLPGRWKPKMIGGIGGFLKVRQYD
QVPIEICGHKVIGSVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       V35X, S68SG, T69N, R83K, A98S, K166R, T200TI, R211K, A272P, K277R, E297K L289LR, A299AG
>CA20019| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALXEICTELEKEGKISKIGPENPYNTPV
FAIKKKDGNKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKARTEVIPLTKEGE
L

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005