<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1157 CA20401 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 13
2 AZT+ DDC 247
3 DDI 30
4 D4T 8
5 3TC+ D4T 8
6 3TC+ D4T+ SQV 13
7 3TC+ D4T+ IDV 107
8 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, I13V, K14KR, Q18H, N37D, L63P, A71V, I72L, V77I, I85V  
>CA20401| codons 1-99
PQITLWQRPIVTVRIGGHLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVLSTVLIGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y A62V     K20R, V35I, K43E, E44A, V118I, K122E, I135T, V179VI, R211K, L228H, A272P, K277R, E297K  
>CA20008| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEAGKISKIGPENPYNTPV
FVIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005