<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1166 CA20382 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 DDC 21
3 D4T 21
4 3TC+ AZT 35
5 AZT+ D4T 17
6 AZT+ D4T+ IDV 13
7 3TC+ D4T+ IDV 47
8 3TC+ D4T+ NFV 31
9 SQV+ RTV+ D4T+ 3TC 9
10 None 55
11 RTV+ IDV+ EFV+ DDI 19
12 IDV+ EFV+ DDI 63

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I15L, L19I, K20R, R41K, L63A, A71V, I93L  
>CA20382| codons 1-99
PQITLWQRPLVTIKLGGQIREALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGHKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Y115F, Q151M V75I, F77L, F116Y, K219E K103N   E6D, V35M, S68G, K122E, I135T, Q145QH, T200I, I202V, V245M, A272P, I293IV, E297D N136NS
>CA19989| codons 1-299
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDGTRWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSTSNETPGIRYHYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKVEELRQHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTDEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005