<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1534 CA20373 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 AZT+DDC 170
3 AZT 57
4 3TC+AZT 17
5 3TC+AZT+IDV 96
6 DLV+NFV+SQV 21
7 D4T+DDI+RTV+SQV 31
8 D4T+DDI+IDV+NFV 43
9 APV+AZT+DDC+EFV+SQV 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73C L10I, R41RK, D60E, I62V, L63P, I64V, K70R, I72E, V77I, I93L  
>CA20373| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYE
QVPVEICGHRAECTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N, Y181C, G190A A98G T39N, K43E, V118I, K122P, D177E, V179T, E203K, Q207E, H208Y, R211K, L228Q, Q278H, T286A, E291D, V292I, I293V  
>CA19979| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEITI
CQYMDDLYVASDLEIGQHRTKIKELREYLWKWGFYTPDKKHQKEPPFQWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTDIVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009