<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4816 CA20370 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 24
2 3TC+D4T+NFV 21
3 3TC+DDI+NVP 17
4 DDI+NVP+RTV+SQV 17
5 ABC+EFV+NFV 27
6 3TC+ABC+AZT+IDV+RTV 34
7 3TC+ABC+APV+AZT+EFV+RTV 32
8 3TC+AZT+EFV+LPV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN N88D L10I, I13IV, K14R, I15V, N37D, K45KR, I62V, L63P, H69HY, V77I, L90X, I93L  
>CA20370| codons 1-99
PQITLWQRPIVTVRVGGQLKEALLDTGADNTVLEEMDLPGRWKPRMIGGIGGFIKVRQYD
QVPIEICGYKAIGTVLIGPTPVNIIGRDLXTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V   K103KN, Y181C, G190S   T27A, K32E, V35L, S68SG, V106I, K122E, S134SR, K173T, Q174R, Q207E, R211K, F214L, H221Y, K223KQ, A272P P140PR, D237EK
>CA19980| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLAEEKIEALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPRINNETRGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTRNPDIVI
CQYMDDLYVSSDLEIGQHRTKIEELREHLLKWGLTTPDKKYQQEPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGI

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005