<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1626 CA20334 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 91
2 DDI 17
3 AZT 21
4 3TC+AZT 30
5 3TC+AZT+SQV 30
6 3TC+AZT+IDV 105
7 3TC+AZT+IDV 17
8 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84IV   L10I, M36MI, N37NS, L63T, H69Q, A71AV, I93IL  
>CA20334| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEISLPGRWKPKIIGGIGGFIKVRQYD
QITIEICGQKVIGTVLVGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     K20R, V35T, V60I, V106I, D123E, I135IV, S162C, K166R, D177DE, I178L, Q197E, F214L, D218E, A272P, K277R, I293V, E297K  
>CA19941| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFRKQNPELVI
YQYVDDLYVGSDLEIGEHRTKIEELRQHLLRWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTKEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005