<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1131 CA20324 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 3TC+D4T+SQV NA
3 Unknown NA
4 None 143
5 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, K14KR, I15V, L19LQ, N37C, R41RK, V82I  
>CA20324| codons 1-99
PQITLWQRPLVAIRVGGQQKEALLDTGADDTVLEEMCLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N T215V, K219Q     V35I, V60I, V118I, K122E, I135T, Q174N, I202V, Q207E, R211K, F214L, I293V  
>CA19931| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKNNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELREHLLKWGLVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005