<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7883 CA20320 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 70
2 3TC+DDC+NFV 155

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D T12TS, I13V, K14KR, I15V, E35D, M36V, N37D, R57K, L63P, A71IT, I93IL  
>CA20320| codons 1-99
PQITLWQRPLVSVRVGGQLKEALLDTGADNTVLEDVDLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKIIGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35X, R83K, K122E, I135T, T200A, E203EK, Q207GR, R211K, T286A, I293V, E297K A299AG
>CA19927| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALXEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIKELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEGE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009