<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7877 CA20311 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 31
2 3TC+AZT 17
3 3TC+AZT+IDV 109
4 D4T+DDI+NFV 121

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90M   L10I, I15V, L19I, R57K, L63A, I66L, A71V, I93L  
>CA20311| codons 1-99
PQITLWQRPIVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVKQYD
QIAIELCGHKVIGTVLVGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q     E6D, T39TA, V60I, K103R, V118I, K122E, F124FL, I142IM, Q197K, T200E, E203D, Q207D, F214L, K223Q, L228LH, Q242K, V245M, A272P, V276T, L283I, A288T, I293V, E297A T131TRS
>CA19917| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DEDLRKYTAFSIPSINNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGKHREKIDELRDHLLRWGLFTPDQKHQQEPPFHWMGYELHPDKWT
VKPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKTKQLCKLIRGTKTLTEVVPLTAEAE

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006