<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7861 CA20290 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT 26
2 DDI+ IDV+ 3TC 13
3 3TC+ D4T+ SQV+ RTV 34
4 3TC+ AZT+ EFV 17
5 3TC+ D4T+ RTV 47
6 Unknown 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82A   K43KQ, L63P, I64L, I93L  
>CA20290| codons 16-99
GGQLKEALLDTGADDTILEEMNLPGRWQPKIVGGIGGFIKVRQYDQIPLEICGHKAIGTV
LVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V       D177E, I178M, V179VG, T200A, Q207E, V245E Q145QP
>CA19898| codons 1-257
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYPYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMGI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005