<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7868 CA20288 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 17
2 3TC+D4T+SQV 74
3 3TC+D4T+IDV 82
4 3TC+D4T+NFV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10V, Q61QH, L63P, I64V, V77I, Q92R, I93L  
>CA20288| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
HIPVEICGHKAIGTVLIGPTPVNIIGRNLMTRLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, M184V       K20R, V35I, I50V, R83K, K122KE, I135T, E138EA, R211K, K249Q, S251I, A288AG G18GA, N136NK, N137NK, R143R*, A299AG
>CA19906| codons 1-300
PISPIETVPVKLKPGMDAPRVKQWPLTEEKIKALIEICTEMEKEGKISKVGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTKKATPGI*YQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEQDIWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKGLTEVIPLTEEGE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009