<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5199 CA20287 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 AZT+DDI 21
3 3TC+AZT+IDV 228

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M Q58E, T74TP L10I, L19Q, L63P, H69R, I93L, C95F  
>CA20287| codons 1-99
PQITLWQRPIVTIKIGGQQKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVREYD
QIPIEICGRKAIGPVLVGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y       K22KN, V35M, T39A, K122E, T200TI, V245E, A288S, T296TS, E297A, E300R K281KE, I293GV
>CA19896| codons 1-300
PISPIETVPVKLKPGMDGPKVNQWPLTEEKIKALMEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCELLRGTKSLTEVGPLSAEAR

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009