<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6416 CA20285 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 86
2 DDC 271
3 3TC+D4T+IDV 74
4 3TC+APV+D4T 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L76V   L10LI, I15V, E35D, N37E, I62V, L63P  
>CA20285| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMELPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKAIGTVVVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K43Q, R83K, V118I, T200A, E203D, R211K, L228R, K238R, I244V, A288S, E297K S268V, Q269K
>CA19894| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIDELRQHLWKWGFYTPDKKHQKEPPFRWMGYELHPDRWT
VQPVVLPEKDSWTVNDIQKLVGKLNWAVKIYAGIKVKQLCKLLRGTKSLTEVIPLTKEA

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005