<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5617 CA20274 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 70
2 3TC+AZT+IDV 105
3 3TC+D4T+IDV 118
4 APV+D4T+EFV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, L90M   L10I, K20I, E35D, M36I, I62V, L63P, I64V, A71V, I72V, I93L  
>CA20274| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKVVGTVVVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K101KE, G190S   E6K, K43N, V118I, K122E, I135V, V179I, V189VI, Q197QH, T200A, E203D, R211KT, L228H, L260LF D17DA, I180IM, Y232YS
>CA19872| codons 1-260
PISPIKTVPVKLKPGMAGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIIM
YQYMDDLYISSDLEIGHHRAKIDELRQHLWTWGFYTPDKKHQKEPPFHWMGSELHPDKWT
VQPIVLPEKDSWTVNDIQKF

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009