<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1813 CA20272 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 112
2 AZT+ 3TC 56
3 3TC+ D4T+ IDV 34
4 IDV+ DDI+ DLV+ 3TC 29
5 SQV+ RTV+ DDI+ 3TC 35
6 3TC+DDI+RTV+SQV+Unknown 15
7 ABC+APV+DDI+RTV+SQV+Unknown 46
8 APV+DDI+RTV+SQV+Unknown 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M N88G L10V, I13V, I15V, K20R, E35D, M36I, K45R, I62V, L63P, A71T, I93L  
>CA20272| codons 1-99
PQITLWQRPVVTVKVGGQLREALLDTGADDTVLEDINLPGRWKPRLIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRGLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, L210W, T215Y K219Q K103N, M230ML   V60I, K102R, V118I, K122E, I135T, H208Y, R211K, F214L, D218E, L228H, R284K, T286A, I293V, E297K I132IR, N136NS
>CA19871| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTRPSTSNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGLYTPEQKHQKEPPFHWLGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVVPLTKEAE
L

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005