<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IN-NARI-4-102 IN-NARI-4-102 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I15V, G16E, L19I, M36V, R41K, L63H, H69K, L89IM, I93L  
>IN-NARI-4-102| codons 1-99
PQITLWQRPLVPIKVEGQIKEALLDTGADDTVLEEVNLPGKWKPKMIGGIGGFIKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, E36EA, T39E, S48T, V60I, I135T, K166KR, K173A, T200AV, Q207G, R211K, V245EK, A272P, K281R, T286TA, E291D, V292T, I293V, V317A  
>IN-NARI-4-102| codons 1-334
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPDIVI
YQYMDDLYVGSDLEIGQHRVKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDTVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Hingankar, NK Initial virologic response and HIV drug resistance among HIV-infected individuals initiating first-line antiretroviral therapy at 2 clinics in Chennai and Mumbai, India. Clin Infect Dis, 2012