<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1469 CA20270 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+AZT 39
3 3TC+AZT+SQV 17
4 3TC+AZT+IDV 52
5 D4T+DDI+NFV 65
6 3TC+RTV+SQV 18
7 3TC+RTV+SQV 5
8 3TC+EFV+RTV+SQV 9
9 3TC+RTV+SQV 13
10 APV+D4T+RTV+SQV 10
11 3TC+APV+D4T+DDI+RTV 59

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54S, V82A, I84IV L33F L10I, G16A, N37D, D60DE, L63P, A71I, V77I, I93L  
>CA20270| codons 1-99
PQITLWQRPIVTIKIAGQLKEALLDTGADDTVFEEMDLPGRWKPKLIVGIGGFSKVRQYE
QIPIEICGHKIIGTVLIGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219EQ     K122E, I135T, I202V, H208Y, R211K, D218E, L228H, V245Q, L283I, T286A, I293V, E297R  
>CA19869| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQYLLKWGFFTPEEKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGAKALTEVVPLTREAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005