<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7848 CA20263 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 230
2 AZT+DDI 9
3 3TC+D4T 90
4 D4T+DDI+NFV 132
5 3TC+ABC+APV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10I, I13V, K20T, I64V, C67W, V77I  
>CA20263| codons 1-99
PQITLWQRPIVTVKIGGQLTEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QILVEIWGHKAIGTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184I, L210W, T215Y D67G, V75VL, K219R     K43KN, E44D, V60I, V118I, K122E, D123E, I135T, I142V, G196E, I202X, E203EK, Q207E, H208Y, R211K, H221HY, K223KE, V245K, A272P  
>CA19878| codons 1-272
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPI
FAIKKKGSDKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLYVGSDLEIEQHRTKXKELREYLWKWGFYTPDRKYQEEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005