<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IN-NARI-4-048 IN-NARI-4-048 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12S, I15V, G16E, L19I, M36I, L63T, H69K, I72IV, I93L  
>IN-NARI-4-048| codons 1-99
PQITLWQRPIVSIKVEGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGKKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36EA, T39D, V60I, D121Y, K122E, D123DE, I135T, S162A, K173A, Q174K, D177E, T200A, Q207E, V245Q, A272P, V276I, K277R, T286A, E291D, V292I, I293V, P294T  
>IN-NARI-4-048| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Hingankar, NK Initial virologic response and HIV drug resistance among HIV-infected individuals initiating first-line antiretroviral therapy at 2 clinics in Chennai and Mumbai, India. Clin Infect Dis, 2012