<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1263 CA20262 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+DDI 52
3 DDI 96
4 D4T 9
5 3TC+AZT 39
6 3TC+AZT+IDV 60
7 3TC+AZT+RTV+SQV 49
8 3TC+D4T+RTV+SQV 46
9 3TC+DDI+EFV+RTV+SQV 7
10 3TC+DDI+RTV+SQV 44
11 3TC+DDI+RTV+SQV 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73GS L10I, R57K, L63P, A71T, V77I, I85IV  
>CA20262| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKTISTVLIGPTPVNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V T215D     I142V, S162C, Q207E, V245I, Q278QE, V292VI, I293V A299AG
>CA19877| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGTKALTEIVPLTEEGE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005