<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8097 CA20256 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 35
2 3TC+AZT+RTV 39
3 3TC+AZT+NFV+NVP 91
4 3TC+ABC+AZT+NFV+NVP 55

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215Y   K103N, Y181C   T139R, D177E, I178M, G196E, I293V, E297K  
>CA20256| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNERPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F I13V, L24F, I62IV, L63P, A71V, V77I, I93L  
>CA20645| codons 1-99
PQITLWQRPLVTVKIGGQLKEALFDTGADDTVFEEMNLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, L28I, V32I, V37I, I72V, S119P, T124N, T125A, I135V, Y227F, S255K, D256E  
>CA125437| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNIPPVIAKEIIASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGPN
FTSNAVKAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYFRDSRDPLWKGPAK
LLWKGEGAVVIQDNKEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005