<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IN-NARI-4-007 IN-NARI-4-007 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36L, R41K, L63P, H69K, K70KR, L89M, I93L  
>IN-NARI-4-007| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, S48T, V60I, D121DY, K122E, I135IATV, K173A, D177EG, T200E, Q207G, R211K, V245Q, A272P, V276I, K277R, E291D, V292I, I293V  
>IN-NARI-4-007| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPGIVI
YQYMDDLYVGSDLEIGQHREKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Hingankar, NK Initial virologic response and HIV drug resistance among HIV-infected individuals initiating first-line antiretroviral therapy at 2 clinics in Chennai and Mumbai, India. Clin Infect Dis, 2012