<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F06_054 F06_054 Canada 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I M36I, N37S, R41K, L63C, A71V, I93L  
>F06_054| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEISLPGKWKPKMIGGIGGFIKVRQYD
QICIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        Q85X, D123E, I135T, S162C, R211K, F214L, A272P, V276I, K277R, I293V, E297T  
>F06_054| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTHDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLLRGTKALTEVVPLTTEAE
LELAENREILKEPV

References
Author Title Citation
Ragonnet-Cronin, M Adaptive evolution of HIV at HLA epitopes is associated with ethnicity in Canada PLoS ONE, 2012