<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F06_021 F06_021 Canada 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LIV, K14KR, L19LQ, R57RK, L63V, E65ED, A71AT  
>F06_021| codons 1-99
PQITLWQRPVVTIRIGGQQKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIVIDICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11KR, K20R, V35I, T39TA, R83K, I135T, T200I, V245E, E291ED, I293V, E297T, K311KR  
>F06_021| codons 1-314
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDVVPLTTEAE
LELAENREILREPV

References
Author Title Citation
Ragonnet-Cronin, M Adaptive evolution of HIV at HLA epitopes is associated with ethnicity in Canada PLoS ONE, 2012