<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C07_060 C07_060 Canada 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I I13V, R41K, D60E, Q61E, L63PS, A71T, I72T, I93L  
>C07_060| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYE
EISIEICGHKTTGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L T215D     E53D, K64R, D123E, I135V, D177E, Q207K, R211K, V245T, I293V, E297K  
>C07_060| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPDNPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLKWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPV

References
Author Title Citation
Ragonnet-Cronin, M Adaptive evolution of HIV at HLA epitopes is associated with ethnicity in Canada PLoS ONE, 2012