<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA789 CA20223 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 DDC 52
3 3TC+D4T 246
4 None 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75T, M184V, T215Y A62V     S68G, K122E, D123N, I178M, T200A, E204D, Q207D, R211K, A288S, I293V I37L
>CA20223| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVELCTELEKEGKISKIGPENPYNTPV
FVIKKKDGTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIEDLRDHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19IV, L33V, N37A, L63H, I64V, K70E, Q92K  
>CA20610| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVVEEMALPGRWKPKMIGGIGGFIKVRQYD
QIHVEICGHEAIGTVLVGPTPVNIIGRNLLTKIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012