<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA634 CA20206 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 AZT+DDI 157
3 D4T 104
4 AZT+DDC+SQV 13
5 3TC+D4T+IDV 56
6 3TC+NVP 5
7 3TC+AZT+RTV+SQV 37
8 3TC+AZT+EFV+RTV+SQV+Unknown 16
9 3TC+AZT+DDI+EFV+RTV+SQV+Unknown 26
10 3TC+AZT+EFV+IDV+RTV+SQV+Unknown 8
11 3TC+AZT+DDI+EFV+IDV+RTV+Unknown 11
12 3TC+AZT+DDI+IDV+RTV+Unknown 14
13 DDI+IDV+RTV 9
14 3TC+DDI+IDV+RTV 4
15 None 3
16 3TC+D4T+RTV+SQV 13
17 None 15
18 3TC+APV+D4T+LPV 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184V, L210W, T215F   K103KN A98AG, V108VI E6K, K43E, E44A, W88C, I94IL, V118I, K122E, I135V, I142V, D177E, I178M, V179X, V189I, G196E, T200A, E203D, H208Y, R211D, H221Y, A272P, A288S L303P
>CA20206| codons 1-303
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLMDFRELNKRTQDFCEVQLGLPHPGGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMXI
YQYVDDLYIGSDLEIEQHRAKIDELRQYLWDWGFFTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A L33F L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71V, I72V, V77I, I85V, I93L  
>CA20600| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFEDIDLPGRWKPKMIVGIGGFTKVRQYD
QVPIEICGHKVVGTVLIGPTPANIVGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005