<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8061 CA20198 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 3TC+AZT+IDV 148
3 D4T+DDI+EFV 86

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103KN, Y188Y*FL   T39A, V106VI, D123E, I135T, S162Y, D177E, V179I, G196GE, Q207E, V241VA Y232YH
>CA20198| codons 1-264
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEIII
YQYMDDLLVGSDLEIEQHRTKIEELREHLWRWGFYTPDKKHQKEPPFLWMGHELHPDKWT
AQPIVLPEKDSWTVNDIQKLVGKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, N37D, L63P, A71V, T74TS, V77I, I93L  
>CA20588| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMDLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGSVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005