<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A10_096 A10_096 Canada 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I T12S, I13V, L19I, N37H, L63S, I64V  
>A10_096| codons 1-99
PQITLWQRPLVSVKIGGQIKEALLDTGADDTVIEEMHLPGRWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35VI, E36ED, V60I, R83K, K122P, I135R, D177DG, I195L, G196E, T200A, I202V, Q207E, R211K, V245K, A272P, E297R, K311R  
>A10_096| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIDICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYMDDLYVGSDLELEQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTREAE
LELAENREILREPV

References
Author Title Citation
Ragonnet-Cronin, M Adaptive evolution of HIV at HLA epitopes is associated with ethnicity in Canada PLoS ONE, 2012