<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4414 CA20174 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 12
2 AZT+ 3TC 9
3 DDI+ D4T+ NVP 24
4 D4T+ NVP 43
5 D4T+ EFV+ SQV 12
6 D4T+ EFV+ SQV 25
7 D4T+ 3TC+ ABC+ NFV+ APV 13
8 Unknown 62

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN, Y181YC   T27S, K49R, V60VI, R83RK, V90I, K102KR, D123E, I135V, D177E, G196GE, R211K  
>CA20174| codons 1-256
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVND

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35ED, N37D, D60DE, L63S  
>CA20563| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYE
QISIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005