<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8042 CA20173 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 63
2 AZT+DDI 10
3 3TC+AZT+IDV 166
4 ABC+D4T+EFV 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, T215Y   Y188L   T39A, V90VI, V106I, I135T, I142V, S162C, T200K, I202V, E203ED, Q207E, H221HY, V245K, K275R, T286A  
>CA20173| codons 1-288
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRKKVDELREHLLRWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLLRGAKA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   L10I, E35D, N37D, R41K, I62V, L63P, A71T, Q92QR, I93L, C95CF  
>CA20562| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMDLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKTIGTVLVGPTPANIIGRNLMTRLGFTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005