<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8035 CA20164 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+EFV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225H I135L, E203D, R211K, I257IR, K277R  
>CA20164| codons 1-291
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELRQHLLKWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDRQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37T, I62V, L63Q, I64V, I72V, N98NK  
>CA20554| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMTLPGRWKPKMIGGIGGFIKVRQYD
QVQVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLKF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005