<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5207 CA20163 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 239
2 3TC+AZT+IDV+RTV 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215FY       V21I, V118I, D123E, I135T, V179I, T200E, F214L, T286P, I293V, E297K  
>CA20163| codons 1-300
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHREKIEELRQHLLRWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGPKALTEVVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M N88D L10I, I15V, Q18H, N37D, K45R, R57K, D60E, I62V, L63P, I66L, A71T, I72M, V77I, I93L  
>CA20551| codons 1-99
PQITLWQRPIVTIKVGGHLKEALLDTGADDTVLEEMDLPGRWKPRMIGGIGGFIKVKQYE
QVPIELCGHKTMGTVLIGPTPVNIIGRDLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005