<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2204 CA20158 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 100
2 AZT+DDI+NFV 39
3 3TC+D4T+NVP 87
4 3TC+D4T+IDV 72
5 3TC+ABC+APV+D4T 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103KN   V35M, K43Q, E44D, K101KQ, V118I, E138Q, S162D, G196E, R211K, Q278H, T286A, I293V, E297R K13N, D86S
>CA20158| codons 1-300
PISPIETVPVKLNPGMDGPKVKQWPLTEEKIKALMEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQSFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTEVVPLTREAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M L10F, N88D R41K, I62V, L63P, V77I, I85V, I93L  
>CA20547| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIVGRDLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005