<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1499 CA20155 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 44
2 DDI 126
3 D4T 52
4 3TC+D4T 65
5 3TC+D4T+IDV 58
6 D4T+NFV+NVP 63
7 3TC+D4T+EFV+RTV+SQV 13
8 APV+D4T+EFV+NFV 30
9 APV+D4T+NFV 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   K103N, Y181C, G190A   K20R, V35M, T39A, K43E, E44D, V118I, D123E, I135IM, D177E, G196E, E203K, Q207E, H208Y, R211K, K223Q, A272P, T286A, E297R  
>CA20155| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVASDLEIEQHRTKIKELREYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTREAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, I84IV, L90M L10F, G73S, L89LV E35D, N37Q, I62V, L63P, A71V, V77I, I93L  
>CA20545| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDMQLPGRWKPKIIGGIGGFLKVRQYD
QVPIEICGHKVISTVLIGPTPVNVIGRNVMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005