<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7995 CA20085 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 3TC+D4T+NVP 188

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, T69D, L74LV, M184V, L210W, T215Y   Y181GV   K43KE, R83K, A98S, K101Q, G196E, T200I, E203X, Q207DN, R211K, H221HY, L228LH, K249Q, D250E A299AG
>CA20085| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKKTQDFWEVQLGIPHPSGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
GQYVDDLYVGSDLEIEQHRIKIXELRDHLWKWGFYTPDKKYQKEPPFHWMGYELHPDKWT
VQPIVLPEQESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEGE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33IV N37X, L63X, I64V, I72IT  
>CA20451| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMXLPGRWKPKMIGGIGGFIKVRQYD
QIXVEICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005